• Featured Product
  • KD/KO Validated

Jagged1/CD339 Monoclonal antibody, PBS Only

Jagged1/CD339 Monoclonal Antibody for WB, ELISA
Cat No. 66890-1-PBS
Clone No.2A7D11

Host / Isotype

Mouse / IgA

Reactivity

human

Applications

WB, ELISA

JAG1, Jagged1, 2A7D11, CD339, HJ1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66890-1-PBS targets Jagged1/CD339 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgA
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11891

Product name: Recombinant human Jagged1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 35-350 aa of BC098393

Sequence: FELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGS

Predict reactive species
Full Name jagged 1 (Alagille syndrome)
Calculated Molecular Weight 1218 aa, 134 kDa
Observed Molecular Weight 150 kDa
GenBank Accession NumberBC098393
Gene Symbol Jagged1
Gene ID (NCBI) 182
RRIDAB_2882220
Conjugate Unconjugated
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDP78504
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Jagged1 is a type I, membrane- anchored, multidomain protein and a ligand of the Notch receptor. The receptor-ligand interaction can trigger the Notch signaling and activate transcription factors that play key roles in cell differentiation and morphogenesis. The predicted MW of Jagged1 is 134 kDa, while higher MW around 150-180 kDa had been observed in literations (PMID: 9716576, 9596653).

Loading...
||
New chat Able
正在加载,请稍候...