Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, HSC-T6 cells, NIH/3T3 cells, SKOV-3 cells |
| Positive IF/ICC detected in | SKOV-3 cells |
This antibody may not be suitable for IHC test.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 14 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
66575-1-Ig targets KAT2A/GCN5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6940 Product name: Recombinant human KAT2A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 537-837 aa of BC032743 Sequence: EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK Predict reactive species |
| Full Name | K(lysine) acetyltransferase 2A |
| Calculated Molecular Weight | 94 kDa |
| Observed Molecular Weight | 94 kDa |
| GenBank Accession Number | BC032743 |
| Gene Symbol | KAT2A |
| Gene ID (NCBI) | 2648 |
| RRID | AB_2881935 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92830 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KAT2A/GCN5 antibody 66575-1-Ig | Download protocol |
| WB protocol for KAT2A/GCN5 antibody 66575-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Brain Behav Immun Kynurenine pathway is altered in BDNF Val66Met knock-in mice: Effect of physical exercise. | ||
J Bone Miner Res Inhibition of ACLY Leads to Suppression of Osteoclast Differentiation and Function Via Regulation of Histone Acetylation. | ||
Development Dynamic profiling and functional interpretation of histone Kcr and Kla during neural development.
| ||
PLoS One Psychostimulants and opioids differentially influence the epigenetic modification of histone acetyltransferase and histone deacetylase in astrocytes. | ||
BMC Cancer Histone regulator KAT2A acts as a potential biomarker related to tumor microenvironment and prognosis of diffuse large B cell lymphoma
| ||
Sci Rep SF3B4 downregulation restrains lung adenocarcinoma tumorigenesis via 5' alternative splicing of KAT2A |









