KAT2A/GCN5 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• KAT2A/GCN5 Monoclonal antibody (66575-1-Ig)

• Featured Product
• KD/KO Validated

KAT2A/GCN5 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66575-1-Ig

Clone No.1F6G7

Publications(35)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

1F6G7, EC:2.3.1.-, EC:2.3.1.48, GCN5, GCN5L2

• 

  WB analysis using 66575-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66575-1-Ig (KAT2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 66575-1-Ig

  WB result of KAT2A/GNC5 antibody (66575-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KAT2A/GNC5 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 66575-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66575-1-Ig (KAT2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66575-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66575-1-Ig (KAT2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SKOV-3 using 66575-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using KAT2A/GCN5 antibody (66575-1-Ig, Clone: 1F6G7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, HSC-T6 cells, NIH/3T3 cells, SKOV-3 cells
• Positive IF/ICC detected in: SKOV-3 cells

This antibody may not be suitable for IHC test.

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66575-1-Ig targets KAT2A/GCN5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6940

  Product name: Recombinant human KAT2A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 537-837 aa of BC032743

  Sequence: EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

• Full Name: K(lysine) acetyltransferase 2A
• Calculated Molecular Weight: 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC032743
• Gene Symbol: KAT2A
• Gene ID (NCBI): 2648
• RRID: AB_2881935
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92830
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,CoIP	Signal Transduct Target Ther; KAT2A-driven succinylation of SRSF11 enforces spliceosome-mediated RAD52 splicing to promote homologous recombination and radioresistance in hepatocellular carcinoma; Authors - Jun Wu
mouse,human	WB	Cell Metab; Cystine import and oxidative catabolism fuel vascular growth and repair via nutrient-responsive histone acetylation.; Authors - Maria-Kyriaki Drekolia
human	WB	Nat Commun; Histone lactylation increases CXCL1 expression for neutrophil infiltration and immune escape in pancreatic cancer.; Authors - Peng Zhang
mouse	WB	Nat Commun; Pyruvate metabolism enzyme Dlat induces mitochondria protein hyperacetylation to limit fatty acid oxidation in the HFpEF heart.; Authors - Ying Wang
rat	WB,IP	J Adv Res; Cadmium targeting transcription factor EB to inhibit autophagy-lysosome function contributes to acute kidney injury; Authors - Peng-Fei Dong ; KD Validated
human	WB	Mol Cell; MYO1F positions cGAS on the plasma membrane to ensure full and functional signaling; Authors - Heping Wang