• Featured Product
  • KD/KO Validated

CoraLite® Plus 750-conjugated KAT2A/GCN5 Monoclonal antibody

KAT2A/GCN5 Monoclonal Antibody for WB
Cat No. CL750-66575
Clone No.1F6G7

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB

GCN5, GCN5L2, hGCN5, Histone acetyltransferase GCN5, HsGCN5, K(lysine) acetyltransferase 2A, KAT2A, Lysine acetyltransferase 2A, PCAF b, STAF97

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, NIH/3T3 cells

This antibody may not be suitable for IHC test.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-66575 targets KAT2A/GCN5 in WB applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6940

Product name: Recombinant human KAT2A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 537-837 aa of BC032743

Sequence: EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

Predict reactive species
Full Name K(lysine) acetyltransferase 2A
Calculated Molecular Weight 94 kDa
Observed Molecular Weight 94 kDa
GenBank Accession NumberBC032743
Gene Symbol KAT2A
Gene ID (NCBI) 2648
RRIDAB_3673718
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92830
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 KAT2A/GCN5 antibody CL750-66575Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...