• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated KAT2A/GCN5 Monoclonal antibody

KAT2A/GCN5 Monoclonal Antibody for FC (Intra)
Cat No. CL488-66575
Clone No.1F6G7

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

FC (Intra)

General control of amino acid synthesis protein 5-like 2, GCN5L2, GCN5, EC:2.3.1.48, EC:2.3.1.-

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inU2OS cells

This antibody may not be suitable for IHC test.

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66575 targets KAT2A/GCN5 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6940

Product name: Recombinant human KAT2A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 537-837 aa of BC032743

Sequence: EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

Predict reactive species
Full Name K(lysine) acetyltransferase 2A
Calculated Molecular Weight 94 kDa
Observed Molecular Weight 94 kDa
GenBank Accession NumberBC032743
Gene Symbol KAT2A
Gene ID (NCBI) 2648
RRIDAB_3672916
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92830
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 KAT2A/GCN5 antibody CL488-66575Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...