KAT2A/GCN5 Monoclonal antibody, PBS Only

• 

  WB analysis using 66575-1-Ig (same clone as 66575-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 66575-1-Ig (KAT2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66575-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66575-1-Ig (same clone as 66575-1-PBS)

  WB result of KAT2A/GNC5 antibody (66575-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KAT2A/GNC5 transfected MCF-7 cells. This data was developed using the same antibody clone with 66575-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66575-1-Ig (same clone as 66575-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66575-1-Ig (KAT2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66575-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66575-1-Ig (same clone as 66575-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66575-1-Ig (KAT2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66575-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SKOV-3 using 66575-1-Ig (same clone as 66575-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using KAT2A/GCN5 antibody (66575-1-Ig, Clone: 1F6G7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66575-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KAT2A/GCN5 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66575-1-PBS

Clone No.1F6G7

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

GCN5, GCN5L2, hGCN5, Histone acetyltransferase GCN5, HsGCN5, K(lysine) acetyltransferase 2A, KAT2A, KAT2A/GCN5, Lysine acetyltransferase 2A, PCAF b, STAF97

---

This antibody may not be suitable for IHC test.

Product Information

66575-1-PBS targets KAT2A/GCN5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6940

  Product name: Recombinant human KAT2A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 537-837 aa of BC032743

  Sequence: EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK

• Full Name: K(lysine) acetyltransferase 2A
• Calculated Molecular Weight: 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC032743
• Gene Symbol: KAT2A
• Gene ID (NCBI): 2648
• RRID: AB_2881935
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92830
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GCN5, encoded by KAT2A, is a member of nuclear A-type histone acetyltransferase (HAT) which has direct impact on gene transcription. Additionally, GCN5 has roles in cell cycle regulation, DNA replication, and DNA repair, highlighting it as key player in the maintenance of genome stability. GCN5 is a coactivator of c-MYC oncogene protein and has oncogenic roles in various cancers.