PCAF Polyclonal antibody

• 

  IP experiment of HeLa using 13983-1-AP

  IP result of anti-PCAF (IP:13983-1-AP, 4ug; Detection:13983-1-AP 1:300) with HeLa cells lysate 2000ug.

• 

  IHC staining of human heart using 13983-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 13983-1-AP (PCAF antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 13983-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 13983-1-AP (PCAF antibody) at dilution of 1:50 (under 40x lens).

PCAF Polyclonal Antibody for IP, IHC, ELISA

Cat No. 13983-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

CAF, Histone acetylase PCAF, Histone acetyltransferase PCAF, K(lysine) acetyltransferase 2B, KAT2B, Lysine acetyltransferase 2B, P/CAF, P300/CBP associated factor, PCAF

---

Tested Applications

• Positive IP detected in: HeLa cells
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

13983-1-AP targets PCAF in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5028

  Product name: Recombinant human KAT2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 483-832 aa of BC060823

  Sequence: EAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

• Full Name: K(lysine) acetyltransferase 2B
• Calculated Molecular Weight: 93 kDa
• GenBank Accession Number: BC060823
• Gene Symbol: PCAF/KAT2B
• Gene ID (NCBI): 8850
• RRID: AB_10643392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Phosphoglycerate dehydrogenase activates PKM2 to phosphorylate histone H3T11 and attenuate cellular senescence; Authors - Yinsheng Wu
human	WB	Mol Cell Proteomics; Acetylproteomic analysis reveals functional implications of lysine acetylation in human spermatozoa (sperm).; Authors - Heguo Yu
human	WB	Exp Cell Res; GRIM-19 inhibits proliferation and induces apoptosis in a p53-dependent manner in colorectal cancer cells through the SIRT7/PCAF/MDM2 axis.; Authors - Ding Wang
human	WB	PLoS One; Psychostimulants and opioids differentially influence the epigenetic modification of histone acetyltransferase and histone deacetylase in astrocytes.; Authors - Mayur Doke