KAT2B/PCAF Recombinant monoclonal antibody

• 

  WB analysis using 86917-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86917-1-RR (KAT2B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86917-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86917-1-RR against Human KAT2B/PCAF were performed. The affinity constant is 2.06 nM.

KAT2B/PCAF Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86917-1-RR

Clone No.251940G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KAT2B, PCAF, CAF, EC:2.3.1.48, EC:2.3.1.57

---

Tested Applications

• Positive WB detected in: HeLa cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86917-1-RR targets KAT2B/PCAF in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30238

  Product name: Recombinant human KAT2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 366-424 aa of BC060823

  Sequence: DQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEAN

• Full Name: K(lysine) acetyltransferase 2B
• Calculated Molecular Weight: 93 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC060823
• Gene Symbol: PCAF/KAT2B
• Gene ID (NCBI): 8850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KAT2B, also known as PCAF (p300/CBP-associated factor), is a crucial transcriptional coactivator that possesses intrinsic histone acetyltransferase (HAT) activity. It primarily acetylates histone H3 at lysine 9 (H3K9ac) and lysine 14 (H3K14ac), a modification associated with open chromatin and active gene transcription. Functionally, PCAF is recruited to promoters by interacting with various transcription factors (such as p53, NF-κB, and nuclear receptors) and larger complexes like the p300/CBP cointegrator complex. It plays pivotal roles in diverse cellular processes, including cell cycle progression, differentiation, metabolism, DNA damage response, and tumor suppression or promotion in a context-dependent manner. Due to its involvement in critical pathways, PCAF is a significant protein of interest in epigenetics, cancer biology, and neurodevelopmental research.