KBTBD10 Polyclonal antibody

KBTBD10 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 25577-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

KBTBD10, Kel like protein 23, Kelch related protein 1, Kelch-like protein 41, KLH41, KLHL41, KRP1, SARCOSIN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, mouse skeletal muscle tissue
Positive IHC detected inhuman heart tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25577-1-AP targets KBTBD10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22311

Product name: Recombinant human KBTBD10 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 205-382 aa of BC006534

Sequence: RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENKDQPLQSYFFQLDSIASEWVGLP

Predict reactive species
Full Name kelch repeat and BTB (POZ) domain containing 10
Calculated Molecular Weight 606 aa, 68 kDa
Observed Molecular Weight 68 kDa
GenBank Accession NumberBC006534
Gene Symbol KBTBD10
Gene ID (NCBI) 10324
RRIDAB_2880137
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60662
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KBTBD10, also named as KBTBD10 or KRP1, is a 606 amino acid protein, which contains one BACK (BTB/Kelch associated) domain, one BTB (POZ) domain and five Kelch repeats. KBTBD10 localizes in the cytoplasm and is expressed in Sarcomeric muscle. KBTBD10 is involved in skeletal muscle development and differentiation. KBTBD10 regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils.

Protocols

Product Specific Protocols
IHC protocol for KBTBD10 antibody 25577-1-APDownload protocol
WB protocol for KBTBD10 antibody 25577-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...