Kv4.2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Kv4.2 Polyclonal antibody (21298-1-AP)

• Featured Product
• KD/KO Validated

Kv4.2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 21298-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA
For FC, select conjugated version.

Synonyms

KCND2, KIAA1044, Potassium voltage-gated channel subfamily D member 2, RK5, Voltage-gated potassium channel subunit Kv4.2

• 

  WB analysis of A549 using 21298-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 21298-1-AP (Kv4.2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21298-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21298-1-AP (Kv4.2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of DU 145 using 21298-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 21298-1-AP (Kv4.2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21298-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21298-1-AP (Kv4.2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 21298-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21298-1-AP (Kv4.2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 21298-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 21298-1-AP (Kv4.2 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 21298-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 21298-1-AP (Kv4.2 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 21298-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Kv4.2 antibody (21298-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Kv4.2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, DU 145 cells, HeLa cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21298-1-AP targets Kv4.2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15879

  Product name: Recombinant human KCND2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 435-630 aa of BC110449

  Sequence: AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

• Full Name: potassium voltage-gated channel, Shal-related subfamily, member 2
• Calculated Molecular Weight: 630 aa, 71 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC110449
• Gene Symbol: KCND2
• Gene ID (NCBI): 3751
• RRID: AB_10733102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Voltage-gated potassium or Kv channels, specifically those mediating low threshold, rapidly inactivating Ito and IA currents, are known to regulate cardiac and neuronal membrane excitability, respectively (PMID: 12829703). Voltage-gated potassium channel subunit Kv4.2, encoded by the KCND2 gene, belongs to the potassium channel family and D (Shal) subfamily. It is a pore-forming alpha subunit of voltage-gated rapidly inactivating A-type potassium channels. Kv4.2 is highly expressed in the brain (PMID: 10551270). It is a major constituent of A-type potassium currents and a key regulator of neuronal membrane excitability (PMID: 22539834).

Publications

What published studies show

The Kv4.2 Polyclonal antibody (Cat# 21298-1-AP) has 14 citations spanning journals including Nature Communications, Neuron, JCI Insight, Life Sciences, Neurobiology of Disease, Molecular Neurobiology, Scientific Reports, eNeuro, Biochemical and Biophysical Research Communications, Journal of Molecular Neuroscience, Biomedical Pharmacotherapy, Acta Physiologica, Aging, and Research Square. Research fields covered include neuroscience (epilepsy, Down syndrome, hippocampal function, dendritic spines), cardiology (arrhythmia, atrial fibrillation, ischemia-reperfusion injury), and oncology (glioblastoma, triple-negative breast cancer), with applications primarily in WB, IF, and IHC.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nat Commun; Synaptic and intrinsic membrane defects disrupt early neural network dynamics in Down syndrome.; Authors - Saad B. Hannan
human	IF	Neuron; Potassium ion channel modulation at cancer-neural interface enhances neuronal excitability in epileptogenic glioblastoma multiforme; Authors - Ye Zhang
	WB	Biomed Pharmacother; Fraxinellone protects against cardiac injury and decreases ventricular fibrillation susceptibility during myocardial ischemia-reperfusion; Authors - Rui Huang
rat	WB,IHC,IF	JCI Insight; Indoxyl sulfate reduces Ito,f by activating ROS/MAPK and NF-κB signaling pathways.; Authors - Jing Yang
mouse	WB	Life Sci; Metformin alleviates hyperkalemia-induced arrhythmia and cardiac injury in mice through decreasing SK2 and intracellular Ca2; Authors - Jie Cui
mouse		Neurobiol Dis; MicroRNA inhibition upregulates hippocampal A-type potassium current and reduces seizure frequency in a mouse model of epilepsy.; Authors - Durgesh Tiwari