• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Kv4.2 Polyclonal antibody

Kv4.2 Polyclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-21298

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

KCND2, Voltage-gated potassium channel subunit Kv4.2, RK5, Potassium voltage-gated channel subfamily D member 2, KIAA1044

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21298 targets Kv4.2 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15879

Product name: Recombinant human KCND2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 435-630 aa of BC110449

Sequence: AAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

Predict reactive species
Full Name potassium voltage-gated channel, Shal-related subfamily, member 2
Calculated Molecular Weight 630 aa, 71 kDa
GenBank Accession NumberBC110449
Gene Symbol KCND2
Gene ID (NCBI) 3751
RRIDAB_3672728
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NZV8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Voltage-gated potassium or Kv channels, specifically those mediating low threshold, rapidly inactivating Ito and IA currents, are known to regulate cardiac and neuronal membrane excitability, respectively (PMID: 12829703). Voltage-gated potassium channel subunit Kv4.2, encoded by the KCND2 gene, belongs to the potassium channel family and D (Shal) subfamily. It is a pore-forming alpha subunit of voltage-gated rapidly inactivating A-type potassium channels. Kv4.2 is highly expressed in the brain (PMID: 10551270). It is a major constituent of A-type potassium currents and a key regulator of neuronal membrane excitability (PMID: 22539834).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Kv4.2 antibody CL488-21298Download protocol
FC protocol for CL Plus 488 Kv4.2 antibody CL488-21298Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...