KCNJ1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCNJ1 Polyclonal antibody, PBS Only (20953-1-PBS)

• 

  WB analysis of mouse brain using 20953-1-AP (same clone as 20953-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20953-1-AP (KCNJ1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20953-1-AP (same clone as 20953-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20953-1-AP (KCNJ1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20953-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 20953-1-AP (same clone as 20953-1-PBS)

  IP result of anti-KCNJ1 (IP:20953-1-AP, 4ug; Detection:20953-1-AP 1:300) with mouse brain tissue lysate 3600ug. This data was developed using the same antibody clone with 20953-1-PBS in a different storage buffer formulation.

KCNJ1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 20953-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

20953-1-PBS targets KCNJ1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15100

  Product name: Recombinant human KCNJ1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 178-391 aa of BC074752

  Sequence: ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 1
• Calculated Molecular Weight: 391 aa, 45 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC074752
• Gene Symbol: KCNJ1
• Gene ID (NCBI): 3758
• RRID: AB_10732600
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48048
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KCNJ1, also called ROMK, is an inward-rectifying K+ channel responsible for basal (non-flow stimulated) K+ secretion. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium. This channel is activated by internal ATP and can be blocked by external barium. The calculated molecule weight is 45kDa, 20953-1-AP can detect the band around 75-80 kDa, it has been considered to be a dimer of KCNJ1.(PMID: 17804670; 7929082; 15767585)