Kir2.2 Polyclonal antibody

• 

  WB analysis of mouse lung using 14135-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 14135-1-AP (Kir2.2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat lung using 14135-1-AP

  rat lung tissue were subjected to SDS PAGE followed by western blot with 14135-1-AP (Kir2.2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HEK-293 using 14135-1-AP

  1x10^6 HEK-293 cells were intracellularly stained with 0.5 ug Kir2.2 Polyclonal antibody (14135-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.5 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Kir2.2 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 14135-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Synonyms

KCNJ12, ATP-sensitive inward rectifier potassium channel 12, hIRK, hIRK1, hkir2.2x

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat lung tissue
• Positive FC (Intra) detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14135-1-AP targets Kir2.2 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5349

  Product name: Recombinant human KCNJ12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-433 aa of BC027982

  Sequence: KMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 12
• Calculated Molecular Weight: 433 aa, 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC027982
• Gene Symbol: Kir2.2
• Gene ID (NCBI): 3768
• RRID: AB_2130478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14500
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.