KCNK9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCNK9 Polyclonal antibody, PBS Only (18033-1-PBS)

• 

  WB analysis using 18033-1-AP (same clone as 18033-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18033-1-AP (KCNK9 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18033-1-PBS in a different storage buffer formulation.

KCNK9 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18033-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

Synonyms

---

Product Information

18033-1-PBS targets KCNK9 in applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12603

  Product name: Recombinant human KCNK9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-374 aa of BC075079

  Sequence: FLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV

• Full Name: potassium channel, subfamily K, member 9
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC075079
• Gene Symbol: KCNK9
• Gene ID (NCBI): 51305
• RRID: AB_3741942
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPC2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.