KCNMB1 Polyclonal antibody

KCNMB1 Polyclonal Antibody for WB, ELISA
Cat No. 12933-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Calcium-activated potassium channel subunit beta-1, Calcium-activated potassium channel subunit beta, BKbeta1, BKbeta, BK channel subunit beta-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse skeletal muscle tissue, rat brain tissue, rat skeletal muscle tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12933-1-AP targets KCNMB1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3888

Product name: Recombinant human KCNMB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-130 aa of BC025707

Sequence: MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQVLNWRDGDTSLYPCQVCEPVPNCPCPRG

Predict reactive species
Full Name potassium large conductance calcium-activated channel, subfamily M, beta member 1
Calculated Molecular Weight130aa,15 kDa; 190aa,22 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC025707
Gene Symbol KCNMB1
Gene ID (NCBI) 3779
RRIDAB_3669151
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16558
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calcium-activated potassium channel subunit beta-1 is a protein encoded by KCNMB1 gene, also named as BK beta1, slo beta1. MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits. Beta subunits (beta 1-4) are highly tissue specific in their expression, with beta-1 being present predominantly on vascular smooth muscle. Endothelial cells are not known to express beta1, subunits. Beta1, is also known to be expressed in urinary bladder and in some regions of the brain. Association of the beta-1 subunit with the BK channel increases the apparent Ca2+ sensitivity of the channel and decreases voltage dependence.PMID 25015960

Protocols

Product Specific Protocols
WB protocol for KCNMB1 antibody 12933-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...