Product Information
29988-1-PBS targets KCNS1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31380 Product name: Recombinant human KCNS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-526 aa of BC075033 Sequence: VTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHQEFEDLLSSVDGVSEASLETSRETSQEGQSADLESQAPSEPPHPQMY Predict reactive species |
| Full Name | potassium voltage-gated channel, delayed-rectifier, subfamily S, member 1 |
| Calculated Molecular Weight | 526 aa, 58 kDa |
| Observed Molecular Weight | 58 kDa |
| GenBank Accession Number | BC075033 |
| Gene Symbol | KCNS1 |
| Gene ID (NCBI) | 3787 |
| RRID | AB_3086205 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96KK3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

