CoraLite® Plus 488-conjugated KCTD2/5/17 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated KCTD2/5/17 Polyclonal antibody (CL488-15553)

• 

  IF Staining of HeLa using CL488-15553

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 KCTD2/5/17 antibody (CL488-15553) at dilution of 1:200.

• Featured Product
• KD/KO Validated

KCTD2/5/17 Polyclonal Antibody for IF/ICC

Cat No. CL488-15553

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

KCTD5, BTB/POZ domain-containing protein KCTD5, KCTD17, KCTD2

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15553 targets KCTD2/5/17 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7915

  Product name: Recombinant human KCTD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC007314

  Sequence: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM

• Full Name: potassium channel tetramerisation domain containing 5
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC007314
• Gene Symbol: KCTD5
• Gene ID (NCBI): 54442
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXV2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

KCTD5 belongs to the human potassium (K+) channel tetramerization domain (KCTD) family of proteins which share sequence similarity with the cytoplasmic domain of voltage-gated K+ channels (Kv channels). The KCTD proteins have relatively conserved N-terminal domains and variable C-termini (PMID: 24268103). KCTD5 interacts with cullin3 and has been proposed to function as substrate adapter for cullin3 based ubiquitin E3 ligases (PMID: 26188516). This polyclonal antibody raised against full-length recombinant protein of human KCTD5 (26 kDa) can cross-react with other KCTD proteins, including KCTD2 (29 kDa), KCTD17 (33-36 kDa).