KCTD4 Polyclonal antibody

• 

  WB analysis using 32898-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32898-1-AP (KCTD4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

KCTD4 Polyclonal Antibody for WB, ELISA

Cat No. 32898-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

BTB/POZ domain-containing protein KCTD4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32898-1-AP targets KCTD4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37112

  Product name: Recombinant human KCTD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC018063

  Sequence: MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK

• Full Name: potassium channel tetramerisation domain containing 4
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC018063
• Gene Symbol: KCTD4
• Gene ID (NCBI): 386618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WVF5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The family of potassium channel tetramerization domain (KCTD) proteins consists of 26 members (PMID: 24268103). Potassium channel tetramerization domain containing 4 (KCTD4) is a protein that interacts with CLIC1 to disrupt calcium homeostasis and promote metastasis in esophageal cancer. KCTD4 expression is upregulated in metastatic esophageal squamous cell carcinoma (ESCC), and high KCTD4 expression is associated with poor prognosis in patients with ESCC. This process activates fibroblasts in a paracrine manner, promoting cancer cell invasion via MMP24 signaling as positive feedback (PMID: 37799381).