KCTD8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCTD8 Polyclonal antibody, PBS Only (23197-1-PBS)

• 

  WB analysis using 23197-1-AP (same clone as 23197-1-PBS)

  Human placenta tissue were subjected to SDS PAGE followed by western blot with 23197-1-AP (KCTD8 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23197-1-PBS in a different storage buffer formulation.

KCTD8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23197-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

23197-1-PBS targets KCTD8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19555

  Product name: Recombinant human KCTD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 360-473 aa of BC136793

  Sequence: CDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL

• Full Name: potassium channel tetramerisation domain containing 8
• Calculated Molecular Weight: 473 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC136793
• Gene Symbol: KCTD8
• Gene ID (NCBI): 386617
• RRID: AB_3669411
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZWB6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GABA-B receptors are G protein-coupled receptors for gamma-aminobutyric acid (GABA). KCTD8 appears to function as an auxiliary GABA-B receptor subunit that may influence the biophysical and/or pharmacologic properties of the receptor response.