KDF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KDF1 Polyclonal antibody, PBS Only (32975-1-PBS)

• 

  WB analysis using 32975-1-AP (same clone as 32975-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32975-1-AP (KDF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32975-1-PBS in a different storage buffer formulation.

KDF1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32975-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C1orf172, Keratinocyte differentiation factor 1

---

Product Information

32975-1-PBS targets KDF1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37124

  Product name: Recombinant human C1orf172 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 96-244 aa of NM_152365.2

  Sequence: RDCLQRCGACVRGCSPCLSTEDSTEGTAEANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSLPSTFASSPRGSEEYYSFHESDLDLPEMGSGSMSSREIDVLIF

• Full Name: chromosome 1 open reading frame 172
• Calculated Molecular Weight: 44 kDa，398aa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_152365.2
• Gene Symbol: C1orf172
• Gene ID (NCBI): 126695
• RRID: AB_3742810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NAX2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.