KDM2A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KDM2A Polyclonal antibody (24311-1-AP)

• Featured Product
• KD/KO Validated

KDM2A Polyclonal Antibody for WB, IP, ELISA

Cat No. 24311-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, CoIP, ChIP, ELISA

Synonyms

[Histone-H3]-lysine-36 demethylase 1A, CXXC8, CXXC-type zinc finger protein 8, EC:1.14.11.27, F box protein FBL7

• 

  WB analysis of Jurkat using 24311-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24311-1-AP (KDM2A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 24311-1-AP

  WB result of KDM2A antibody (24311-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KDM2A transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 24311-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 24311-1-AP (KDM2A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 24311-1-AP

  IP result of anti-KDM2A (IP:24311-1-AP, 4ug; Detection:24311-1-AP 1:600) with HeLa cells lysate 1600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KDM2A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24311-1-AP targets KDM2A in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19448

  Product name: Recombinant human KDM2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 374-558 aa of BC064360

  Sequence: DEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAAS

• Full Name: lysine (K)-specific demethylase 2A
• Calculated Molecular Weight: 1162 aa, 133 kDa
• Observed Molecular Weight: 126 kDa
• GenBank Accession Number: BC064360
• Gene Symbol: KDM2A
• Gene ID (NCBI): 22992
• RRID: AB_2879488
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2K7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KDM2A(Lysine-specific demethylase 2A) is also named as CXXC8, FBL7, FBXL11, JHDM1A, KIAA1004 and belongs to the JHDM1 histone demethylase family. It is required to maintain the heterochromatic state, and playing a role in epigenetic silencing. KDM2A is one of the four subunits of the E3 ubiquitin protein ligase complex (SCF) with SKP1, CUL1, RBX1, Fbox protein bringing ubiquitin conjugating enzymes to substrates recruited by F-box.

Publications

What published studies show

The KDM2A Polyclonal antibody (Cat# 24311-1-AP) has 11 citations published in journals including Nature Communications, Advanced Science, Cell Death & Disease, International Journal of Biological Sciences, Cell Reports, Cells, Cell Oncology, Biomolecules, Journal of Cellular and Molecular Medicine, Clinical and Molecular Hepatology, and Journal of Cellular Physiology. Research fields span oncology (ovarian, oral squamous cell, breast, and liver cancer), epigenetics, atherosclerosis, viral hepatitis, RNA biology, and early embryonic development.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Clin Mol Hepatol; GDH1-dependent α-ketoglutarate promotes HBV transcription by modulating histone methylations on the cccDNA minichromosome; Authors - Sheng-Tao Cheng
mouse	CoIP	Nat Commun; NLRP14 modulates the activity of E3 ubiquitin ligases during the oocyte-to-embryo transition.; Authors - Sibei Liu
human	WB	Adv Sci (Weinh); Targeting Intratumoral Copper Inhibits Tumor Progression via p62-Mediated EZH2 Degradation and Potentiates Anti-PD-1 Immunotherapy in Oral Squamous Cell Carcinoma; Authors - Xiaohu Lin
human	WB,IHC	Cell Death Dis; CircRNF144B/miR-342-3p/FBXL11 axis reduced autophagy and promoted the progression of ovarian cancer by increasing the ubiquitination of Beclin-1; Authors - Wenting Song
human	WB,IF	Int J Biol Sci; Macrophage KDM2A promotes atherosclerosis via regulating FYN and inducing inflammatory response; Authors - Yuzhou Xue
human	WB,IP	Cell Rep; Enhancer RNAs Mediate Estrogen-Induced Decommissioning of Selective Enhancers by Recruiting ERα and Its Cofactor.; Authors - Mei Yang