KDM5D Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KDM5D Polyclonal antibody, PBS Only (22739-1-PBS)

• 

  WB analysis using 22739-1-AP (same clone as 22739-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22739-1-AP (KDM5D antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22739-1-PBS in a different storage buffer formulation.

KDM5D Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22739-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22739-1-PBS targets KDM5D in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18690

  Product name: Recombinant human KDM5D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1375-1482 aa of BC146767

  Sequence: SRTRSRALERRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL

• Full Name: lysine (K)-specific demethylase 5D
• Calculated Molecular Weight: 1482 aa, 167 kDa
• Observed Molecular Weight: 70 kDa, 175 kDa
• GenBank Accession Number: BC146767
• Gene Symbol: KDM5D
• Gene ID (NCBI): 8284
• RRID: AB_2879160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BY66
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.