KEL Monoclonal antibody

• Home
• Products
• Primary Antibodies
• KEL Monoclonal antibody (67393-1-Ig)

KEL Monoclonal Antibody for WB, ELISA

Cat No. 67393-1-Ig Copied!

Clone No. 1C8B6

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

Human and More (1)

Applications

WB, ELISA

Synonyms

CD238, ECE3, KEL, Kell blood group glycoprotein

• 

  WB analysis of human red blood cells using 67393-1-Ig

  human red blood cells were subjected to SDS PAGE followed by western blot with 67393-1-Ig (KEL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human red blood cells using 67393-1-Ig

  human red blood cells were subjected to SDS PAGE followed by western blot with 67393-1-Ig (KEL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KEL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human red blood cells

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:15000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67393-1-Ig targets KEL in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28192

  Product name: Recombinant human KEL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 70-311 aa of BC050639

  Sequence: QNCGPRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQYGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQKIYAQIFREYLTYLNQLGTLLGGDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKLFQMVTIDQLKEMA

• Full Name: Kell blood group, metallo-endopeptidase
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC050639
• Gene Symbol: KEL
• Gene ID (NCBI): 3792
• RRID: AB_2882637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23276
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The KEL Monoclonal antibody (1C8B6), catalog number 67393-1-Ig, has 2 total citations. Both appear in Science Advances and bioRxiv, from the same research group (Podszywałow-Bartnicka et al.). The studies focus on transcriptional readthrough and alternative splicing programs in chronic myeloid leukemia (CML) cells treated with imatinib, placing the citations within the fields of oncology, RNA biology, and targeted cancer therapy.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Transcriptional readthrough precedes alternative splicing programs triggered in CML cells by imatinib.; Authors - Paulina Podszywałow-Bartnicka
human	WB	bioRxiv; Transcriptional readthrough precedes alternative splicing programs triggered in CML cells by imatinib.; Authors - Paulina Podszywałow-Bartnicka