• Featured Product
  • KD/KO Validated

KHSRP Recombinant monoclonal antibody, PBS Only

KHSRP Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA
Cat No. 82931-1-PBS
Clone No.230189G1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

230189G1, Far upstream element-binding protein 2, FBP2, FUBP2, FUSE-binding protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82931-1-PBS targets KHSRP in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33890

Product name: Recombinant human KHSRP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 600-710 aa of NM_003685

Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ

Predict reactive species
Full Name KH-type splicing regulatory protein
Calculated Molecular Weight73 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberNM_003685
Gene Symbol KHSRP
Gene ID (NCBI) 8570
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92945
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KHSRP, also named as FUBP2, KSRP, and p75, belongs to the KHSRP family. It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possi3bly by recruiting degradation machinery to ARE-containing mRNAs.

Loading...
||
New chat Able
正在加载,请稍候...