• Featured Product
  • KD/KO Validated

Ki-67 Polyclonal antibody

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. 27309-1-AP
Publications(1461)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IF-P, FC (Intra), ELISA

KI67, MKI67, Antigen identified by monoclonal antibody Ki-67, Antigen KI-67, Ki 67

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, human skin cancer tissue, human lymphoma tissue, human breast cancer tissue, Insulinoma tissue, K-562 cells
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lung cancer tissue
Positive IF/ICC detected inHeLa cells, HEK-293 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27309-1-AP targets Ki-67 in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26266

Product name: Recombinant human KI67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1201-1300 aa of NM_002417

Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

Predict reactive species
Full Name antigen identified by monoclonal antibody Ki-67
Calculated Molecular Weight 359 kDa
GenBank Accession NumberNM_002417
Gene Symbol KI67
Gene ID (NCBI) 4288
RRIDAB_2756525
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46013
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.

Protocols

Product Specific Protocols
FC protocol for Ki-67 antibody 27309-1-APDownload protocol
IF protocol for Ki-67 antibody 27309-1-APDownload protocol
IHC protocol for Ki-67 antibody 27309-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IHC

Signal Transduct Target Ther

FBXW7β loss-of-function enhances FASN-mediated lipogenesis and promotes colorectal cancer growth

Authors - Wenxia Wei
IHC

Mol Cancer

lncRNA ZNRD1-AS1 promotes malignant lung cell proliferation, migration, and angiogenesis via the miR-942/TNS1 axis and is positively regulated by the m6A reader YTHDC2

Authors - Jin Wang
IHC

Mol Cancer

Cell surface CD55 traffics to the nucleus leading to cisplatin resistance and stemness by inducing PRC2 and H3K27 trimethylation on chromatin in ovarian cancer

Authors - Rashmi Bharti
humanIHC

Cancer Discov

Stress Granules determine the Development of Obesity-associated Pancreatic Cancer.

Authors - Guillaume Fonteneau
IF

Adv Mater

Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration

Authors - Zhuo Li
IHC

Protein Cell

NDFIP1 limits cellular TAZ accumulation via exosomal sorting to inhibit NSCLC proliferation

Authors - Yirui Cheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (08-12-2025)

Worked well in Western, also detected a non specific band at 70 kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: MSCs
FH

Celine (Verified Customer) (07-09-2025)

Works well in immunoflurescence with fixed cells

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500 O/N
  • Cell Tissue Type: glioblastoma cell lines
Ki-67 Antibody Immunofluorescence validation (1:500 O/N dilution) in glioblastoma cell lines (Cat no:27309-1-AP)
FH

Guo-rong (Verified Customer) (08-30-2022)

Clear staining

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: ARPE-19
Ki-67 Antibody Immunofluorescence validation (1:200 dilution) in ARPE-19 (Cat no:27309-1-AP)
FH

Alessandro (Verified Customer) (07-27-2022)

No aspecific staining, great outcome

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: ARPE-19
FH

Ana (Verified Customer) (02-15-2022)

Both, 1:50 and 1:100 dilutions worked well

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50, 1:100
  • Cell Tissue Type: ARPE-19
FH

kes (Verified Customer) (01-17-2022)

Works at 1:200 dilution for IHC

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: murine tissues
FH

Yan (Verified Customer) (02-18-2020)

1:100 work for cell.

  • Applications: Immunofluorescence,
Loading...
||
New chat

Able

正在加载,请稍候...