• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Ki-67 Polyclonal antibody

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.
Cat No. CL488-27309

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

MKI67, KI67, Proliferation marker protein Ki-67, Ki 67, Antigen KI-67

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inRamos cells, HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 2 publications below

Product Information

CL488-27309 targets Ki-67 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26266

Product name: Recombinant human KI67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1201-1300 aa of NM_002417

Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

Predict reactive species
Full Name antigen identified by monoclonal antibody Ki-67
Calculated Molecular Weight 359 kDa
GenBank Accession NumberNM_002417
Gene Symbol KI67
Gene ID (NCBI) 4288
RRIDAB_2919213
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46013
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Ki-67 antibody CL488-27309Download protocol
IF protocol for CL Plus 488 Ki-67 antibody CL488-27309Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

J Biochem Mol Toxicol

LncRNA LINC01703 promotes the proliferation, migration, and invasion of colorectal cancer by activating PI3K/AKT pathway

Authors - Yuanhui Xu
humanIF

World J Gastrointest Oncol

Bidirectional effects of the tryptophan metabolite indole-3-acetaldehyde on colorectal cancer

Authors - Ze Dai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Shriya (Verified Customer) (10-04-2025)

CoraLite® Plus 488-conjugated Ki-67 Polyclonal antibody

  • Applications: Immunofluorescence
  • Cell Tissue Type: human
Loading...
||
New chat

Able

正在加载,请稍候...