CoraLite®594-conjugated Ki-67 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite®594-conjugated Ki-67 Polyclonal antibody (CL594-27309)

• Featured Product
• KD/KO Validated

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. CL594-27309 Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

KI67, MKI67, Antigen identified by monoclonal antibody Ki-67, Antigen KI-67, Ki 67

• 

  IF Staining of HeLa using CL594-27309

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 Ki-67 antibody (CL594-27309) at dilution of 1:200, CL488-Phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using CL594-27309

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 KI67 antibody (CL594-27309) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using CL594-27309

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 KI67 antibody (CL594-27309) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using CL594-27309

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human KI67 (CL594-27309) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Ramos using CL594-27309

  1x10^6 Ramos cells were intracellularly stained with 0.8 ug CoraLite®594 Anti-Human KI67 (CL594-27309)(red), or 0.8 ug CoraLite®594-conjugated Rabbit IgG control Rabbit PolyAb (CL594-30000) (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Ki-67 in ?

Chat with Able

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: Ramos cells, HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 ul suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-27309 targets Ki-67 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26266

  Product name: Recombinant human KI67 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1201-1300 aa of NM_002417

  Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

• Full Name: antigen identified by monoclonal antibody Ki-67
• Calculated Molecular Weight: 359 kDa
• GenBank Accession Number: NM_002417
• Gene Symbol: KI67
• Gene ID (NCBI): 4288
• RRID: AB_2919880
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46013
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.

Publications

What published studies show

CL594-27309 is the CoraLite®594-conjugated Ki-67 polyclonal antibody, with 1 citation total. The article appears in Oncology Reports (July 2024). The research field associated with the citation is cancer biology, specifically colorectal cancer, studying how zinc finger protein 180 induces an apoptotic phenotype by activating METTL14 transcriptional activity. The antibody was used in immunofluorescence (IF) applications on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Oncol Rep; Zinc finger protein 180 induces an apoptotic phenotype by activating METTL14 transcriptional activity in colorectal cancer; Authors - Liang Xu