TTI1 Polyclonal antibody

• 

  WB analysis of HeLa using 22381-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22381-1-AP (TTI1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 22381-1-AP

  IP result of anti-TTI1 (IP:22381-1-AP, 4ug; Detection:22381-1-AP 1:1000) with HeLa cells lysate 1600ug.

TTI1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 22381-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

KIAA0406, TTI1

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

22381-1-AP targets TTI1 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17697

  Product name: Recombinant human KIAA0406 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 740-1089 aa of BC013755

  Sequence: DVLATLDQFYDKRAASFVSVLHALMAALAQWFPDTGNLGHLQEQSLGEEGSHLNQRPAALEKSTTTAEDIEQFLLNYLKEKDVADGNVSDFDNEEEEQSVPPKVDENDTRPDVEPPLPLQIQIAMDVMERCIHLLSDKNLQIRLKVLDVLDLCVVVLQSHKNQLLPLAHQAWPSLVHRLTRDAPLAVLRAFKVLRTLGSKCGDFLRSRFCKDVLPKLAGSLVTQAPISARAGPVYSHTLAFKLQLAVLQGLGPLCERLDLGEGDLNKVADACLIYLSVKQPVKLQEAARSVFLHLMKVDPDSTWFLLNELYCPVQFTPPHPSLHPVQLHGASGQQNPYTTNVLQLLKELQ

• Full Name: KIAA0406
• Calculated Molecular Weight: 1089 aa, 122 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC013755
• Gene Symbol: TTI1
• Gene ID (NCBI): 9675
• RRID: AB_2879094
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O43156
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; Ivermectin represses Wnt/β-catenin signaling by binding to TELO2, a regulator of phosphatidylinositol 3-kinase-related kinases.; Authors - Honami Yonezawa