KIAA1024 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIAA1024 Polyclonal antibody, PBS Only (32467-1-PBS)

• 

  WB analysis using 32467-1-AP (same clone as 32467-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32467-1-AP (KIAA1024 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32467-1-PBS in a different storage buffer formulation.

KIAA1024 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32467-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

Major intrinsically disordered Notch2-binding receptor 1, Membrane integral NOTCH2-associated receptor 1, MINAR1, Ubiquitination and mTOR signaling protein, UBTOR

---

Product Information

32467-1-PBS targets KIAA1024 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38274

  Product name: Recombinant human KIAA1024 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 742-891 aa of NM_015206.2

  Sequence: VGLNEEEIKDTGPGDNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAHMKSNPLYTDMRLTELAEVKRGQPSWTIEEYARNAGDKGKLTALDLQTQESLNPNNLEYWMEDIYTPGYDSLLKRKEAEFRRAKVCK

• Full Name: KIAA1024
• Calculated Molecular Weight: 103kDa，916aa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: NM_015206.2
• Gene Symbol: KIAA1024
• Gene ID (NCBI): 23251
• RRID: AB_3742619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UPX6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIAA1024 negatively regulates the activities of mTORC1 and mTORC2 by stabilizing the MTOR complex inhibitor DEPTOR, thus inhibiting cell overgrowth. In cultured hippocampal neurons and PC12 cells, knocking down KIAA1024 can activate mTOR signal and promote neurite outgrowth. However, in zebrafish and mouse transplanted tumor models, deletion of this gene will significantly enhance the tumor formation induced by HRAS(G12V), suggesting that it has antitumor effect.