KIAA1211 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIAA1211 Polyclonal antibody, PBS Only (32570-1-PBS)

• 

  WB analysis using 32570-1-AP (same clone as 32570-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32570-1-AP (KIAA1211 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32570-1-PBS in a different storage buffer formulation.

KIAA1211 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32570-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Cancer-related regulator of actin dynamics, Capping protein-inhibiting regulator of actin dynamics, CRACD, CRAD

---

Product Information

32570-1-PBS targets KIAA1211 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38501

  Product name: Recombinant human KIAA1211 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-580 aa of NM_020722.1

  Sequence: LEDQERLKPEGQREHSEEPGICEEQNPEAERRREQQGRSGDFQGADRPGPEEKREEGDTEPLLKQEGPVEAAQPPVERKEAAALEQGRKVEELRWQEVDERQTMPRPYTFQVSSGGKQILFPKVNLSPVTPAKDTGLTAAPQEPKAPKASP

• Full Name: KIAA1211
• Calculated Molecular Weight: 137kDa，1233aa
• Observed Molecular Weight: 137 kDa
• GenBank Accession Number: NM_020722.1
• Gene Symbol: KIAA1211
• Gene ID (NCBI): 57482
• RRID: AB_3742658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZU35
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIAA1211 locates at human chromosome 4q12, and has only one transcript (NM_020722.1, 4914 bp). KIAA1211 encoded a 137 kDa nuclear protein and highly expressed in the brain cerebral cortex. Furthermore, it is localized to the microtubules and the centrosomes and is subcellularly located in the nucleus. In recent years, it has been found that the KIAA1211 gene is closely associated with the development and prognosis of various cancers (PMID: 31777604).