KIAA1217 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIAA1217 Polyclonal antibody, PBS Only (24880-1-PBS)

• 

  WB analysis using 24880-1-AP (same clone as 24880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24880-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 24880-1-AP (same clone as 24880-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24880-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24880-1-AP (same clone as 24880-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24880-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24880-1-AP (same clone as 24880-1-PBS)

  Rat colon lysates were subjected to SDS PAGE followed by western blot with 24880-1-AP (KIAA1217 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24880-1-PBS in a different storage buffer formulation.

KIAA1217 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24880-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24880-1-PBS targets KIAA1217 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19367

  Product name: Recombinant human KIAA1217 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 534-852 aa of BC018764

  Sequence: PAQNLPHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKNRAVSIEKAEKKWEEKRQNLDHYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAPVDKVELSEDSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENITAKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSSKDEEEEEEEGDKIMAELQAFQKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKSDVEYENGPQMEFQKGSSGAPQTSRMPVPMSAKNR

• Full Name: KIAA1217
• Calculated Molecular Weight: 1943 aa, 214 kDa
• Observed Molecular Weight: 100-110 kDa, 140-160 kDa, 210 kDa
• GenBank Accession Number: BC018764
• Gene Symbol: KIAA1217
• Gene ID (NCBI): 56243
• RRID: AB_2879775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T5P2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIAA1217, sickle tail protein homolog, is required for normal development of intervertebral disks. It promotes epithelial-mesenchymal transition and hepatocellular carcinoma metastasis by interacting with and activating STAT3, indicating its potential as a therapeutic target for curbing HCC metastasis (PMID: 35008530). It is also a novel candidate gene associated with isolated and syndromic vertebral malformations (PMID: 32369272). KIAA1217 has 9 alternatively spliced isoforms of 100-110 kDa, 140-160 kDa, 210 kDa.