KIAA1217 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83361-2-RR (same clone as 83361-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83361-2-RR (KIAA1217 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83361-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 83361-2-RR (same clone as 83361-2-PBS)

  WB result of KIAA1217 antibody (83361-2-RR; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KIAA1217 transfected HEK-293 cells. This data was developed using the same antibody clone with 83361-2-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 83361-2-RR (same clone as 83361-2-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug KIAA1217 Recombinant antibody (83361-2-RR, Clone:240276F3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83361-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00371-1

  Cytometric bead array standard curve of MP00371-1, KIAA1217 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83361-2-PBS. Detection antibody: 83361-1-PBS. Standard: Ag19367. Range: 0.78-100ng/mL.

• 

  Affinity and Kinetic Characterization of 83361-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83361-2-RR against Human KIAA1217 were performed. The affinity constant is 1.46 nM.

• Featured Product
• KD/KO Validated

KIAA1217 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83361-2-PBS

Clone No.240276F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

240276F3, Sickle tail protein homolog, SKT

---

Product Information

83361-2-PBS targets KIAA1217 as part of a matched antibody pair:

MP00371-1: 83361-2-PBS capture and 83361-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19367

  Product name: Recombinant human KIAA1217 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 534-852 aa of BC018764

  Sequence: PAQNLPHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKNRAVSIEKAEKKWEEKRQNLDHYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAPVDKVELSEDSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENITAKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSSKDEEEEEEEGDKIMAELQAFQKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKSDVEYENGPQMEFQKGSSGAPQTSRMPVPMSAKNR

• Full Name: KIAA1217
• Calculated Molecular Weight: 1943 aa, 214 kDa
• Observed Molecular Weight: 100-110, 140-160, 210
• GenBank Accession Number: BC018764
• Gene Symbol: KIAA1217
• Gene ID (NCBI): 56243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5T5P2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIAA1217, sickle tail protein homolog, is required for normal development of intervertebral disks. It promotes epithelial-mesenchymal transition and hepatocellular carcinoma metastasis by interacting with and activating STAT3, indicating its potential as a therapeutic target for curbing HCC metastasis (PMID: 35008530). It is also a novel candidate gene associated with isolated and syndromic vertebral malformations (PMID: 32369272). KIAA1217 has 9 alternatively spliced isoforms of 100-110 kDa, 140-160 kDa, 210 kDa.