• Featured Product
  • KD/KO Validated

KIAA1217 Recombinant monoclonal antibody, PBS Only (Capture)

KIAA1217 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83361-2-PBS
Clone No.240276F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

240276F3, Sickle tail protein homolog, SKT

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83361-2-PBS targets KIAA1217 as part of a matched antibody pair:

MP00371-1: 83361-2-PBS capture and 83361-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19367

Product name: Recombinant human KIAA1217 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 534-852 aa of BC018764

Sequence: PAQNLPHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKNRAVSIEKAEKKWEEKRQNLDHYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAPVDKVELSEDSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENITAKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSSKDEEEEEEEGDKIMAELQAFQKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKSDVEYENGPQMEFQKGSSGAPQTSRMPVPMSAKNR

Predict reactive species
Full Name KIAA1217
Calculated Molecular Weight 1943 aa, 214 kDa
Observed Molecular Weight100-110 kDa, 140-160 kDa, 210 kDa
GenBank Accession NumberBC018764
Gene Symbol KIAA1217
Gene ID (NCBI) 56243
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5T5P2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KIAA1217, sickle tail protein homolog, is required for normal development of intervertebral disks. It promotes epithelial-mesenchymal transition and hepatocellular carcinoma metastasis by interacting with and activating STAT3, indicating its potential as a therapeutic target for curbing HCC metastasis (PMID: 35008530). It is also a novel candidate gene associated with isolated and syndromic vertebral malformations (PMID: 32369272). KIAA1217 has 9 alternatively spliced isoforms of 100-110 kDa, 140-160 kDa, 210 kDa.

Loading...
||
New chat Able
正在加载,请稍候...