Shootin 1 Polyclonal antibody

• 

  WB analysis of Neuro-2a using 24383-1-AP

  WB result of Shootin 1 antibody (24383-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Shootin 1 transfected Neuro-2a cells.

• 

  WB analysis using 24383-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24383-1-AP (Shootin 1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human bowen disease using 24383-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 24383-1-AP (Shootin 1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human bowen disease using 24383-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 24383-1-AP (Shootin 1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Shootin 1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24383-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SHTN1, KIAA1598, Shootin-1

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, Neuro-2a cells, SK-N-SH cells
• Positive IHC detected in: human bowen disease; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

24383-1-AP targets Shootin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18294

  Product name: Recombinant human KIAA1598 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 834-1066 aa of BC022348

  Sequence: TEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKTKPESSKGCESAVDELKGILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEADSSSPTGILATSESKSMPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPPSSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKEDEGEIQPENKEDSIENVRETDSSNC

• Full Name: KIAA1598
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 60-80 kDa
• GenBank Accession Number: BC022348
• Gene Symbol: Shootin 1
• Gene ID (NCBI): 57698
• RRID: AB_2879517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0MZ66
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Shootin 1, also known as SHTN1, KIAA1598, contains 3 coiled-coil domains and a proline-rich region. Shootin 1 is involved in generating internal asymmetric signals required for neuronal during stages 2 and 3. Shootin 1 plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone. SHTN1 produces 2 splice variants, a short variant, SHTN1S, that lacks exons 15 and 16, and a long variant, SHTN1L, that includes exons 1 through 17(PMID: 17030985, 30733148).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cancer Genet; Data-mining-based biomarker evaluation and experimental validation of SHTN1 for bladder cancer; Authors - Yueying Wang