KIAA1797 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIAA1797 Polyclonal antibody, PBS Only (30140-1-PBS)

• 

  WB analysis using 30140-1-AP (same clone as 30140-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30140-1-AP (KIAA1797 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 30140-1-AP (same clone as 30140-1-PBS)

  WB result of KIAA1797 antibody (30140-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KIAA1797 transfected HeLa cells. This data was developed using the same antibody clone with 30140-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KIAA1797 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30140-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30140-1-PBS targets KIAA1797 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31233

  Product name: Recombinant human KIAA1797 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 230-502 aa of BC001246

  Sequence: LLSEATGKIFDLLPNKIRRKDLELYISIAKCLLEMTDDDANRIAQVTKSNIEKAAFVKLYLVSQGRFPLVNLTDMLSVAVQHREKEVLAWMILHSLYQARIVSHANTGVLKRMEWLLELMGYIRNVAYQSTSFHNTALDEALDFFLLIFATAVVAWADHTAPLLLGLSASWLPWHQENGPAGPVPSFLGRSPMHRVTLQEVLTLLPNSMALLLQKEPWKEQTQKFIDWLFSIMESPKEALSAQSRDLLKATLLSLRVLPEFKKKAVWTRAYGW

• Full Name: KIAA1797
• Observed Molecular Weight: 160-170 kDa
• GenBank Accession Number: BC001246
• Gene Symbol: KIAA1797
• Gene ID (NCBI): 54914
• RRID: AB_3086244
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VW36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIAA1797 is a novel component of the focal adhesion complex expressed in glial and neuronal cells with a tumour suppressor function in gliomas, which is also named 'focadhesin' (PMID: 22427331).