KIAA1984 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIAA1984 Polyclonal antibody, PBS Only (20945-1-PBS)

• 

  WB analysis of HeLa using 20945-1-AP (same clone as 20945-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20945-1-AP (KIAA1984 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20945-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 20945-1-AP (same clone as 20945-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20945-1-AP (KIAA1984 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20945-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20945-1-AP (same clone as 20945-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HepG2 cells using 20945-1-AP (KIAA1984 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20945-1-PBS in a different storage buffer formulation.

KIAA1984 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 20945-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20945-1-PBS targets KIAA1984 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15053

  Product name: Recombinant human KIAA1984 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 426-495 aa of BC007542

  Sequence: QREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEKYNTRISFENREEDMI

• Full Name: KIAA1984
• Calculated Molecular Weight: 534 aa, 63 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC007542
• Gene Symbol: KIAA1984
• Gene ID (NCBI): 84960
• RRID: AB_2878772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T5S1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.