KIF13B Polyclonal antibody

• 

  WB analysis using 30141-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30141-1-AP (KIF13B antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 30141-1-AP

  WB result of KIF13B antibody (30141-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KIF13B transfected HepG2 cells.

• 

  IP experiment of HEK-293 using 30141-1-AP

  IP result of anti-KIF13B (IP:30141-1-AP, 4ug; Detection:30141-1-AP 1:800) with HEK-293 cells lysate 1400 ug.

• 

  IHC staining of human stomach cancer using 30141-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30141-1-AP (KIF13B antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 30141-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30141-1-AP (KIF13B antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

KIF13B Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 30141-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

GAKIN, KIAA0639, kinesin family member 13B

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30141-1-AP targets KIF13B in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30876

  Product name: Recombinant human KIF13B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1648-1826 aa of NM_015254

  Sequence: VRRVRASELRSFSRMLAGDPGCSPGAEGNAPAPGAGGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATNLASLTAALAKADRSHKNPENRKSWAS

• Full Name: kinesin family member 13B
• Calculated Molecular Weight: 203 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: NM_015254
• Gene Symbol: KIF13B
• Gene ID (NCBI): 23303
• RRID: AB_3086245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQT8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIF13B, Also known as GAKIN, is a 250-kD phosphoprotein. KIF13B contains a consensus ATP/GTP-binding motif within its N-terminal motor domain; a stalk domain containing several short alpha-helical segments; and a CAP-gly motif in its C terminus characteristic of microtubule-based cytoskeleton components(PMID: 10859302).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Am J Physiol Cell Physiol; PCP protein Prickle 1 regulates Sertoli cell and testis function via cytoskeletal organization through the recruitment of multiple regulatory proteins; Authors - Lingling Wang