Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, MG-63 cells, HEK-293 cells, Jurkat cells, HL-60 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, BT-549 cells, MDA-MB-468 cells |
| Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67190-1-Ig targets KIF20A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8916 Product name: Recombinant human KIF20A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-351 aa of BC012999 Sequence: MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQD Predict reactive species |
| Full Name | kinesin family member 20A |
| Calculated Molecular Weight | 890 aa, 100 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC012999 |
| Gene Symbol | KIF20A |
| Gene ID (NCBI) | 10112 |
| RRID | AB_2882485 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O95235 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KIF20A, also known as RAB6KIFL or MKlp2, is a kinesin originally identified as a binding partner for the rab6 GTPase involved in protein transport at the Golgi apparatus. KIF20A belongs to a large family of motor proteins that accumulate in mitotic cells and is required for normal cell division. KIF20A is thought to be involved in carcinogenesis. In normal tissues KIF20A is almost undetectable while it is overexpressed in various cancers. KIF20A has been identified as a novel promising candidate for anticancer immunotherapy.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIF20A antibody 67190-1-Ig | Download protocol |
| IHC protocol for KIF20A antibody 67190-1-Ig | Download protocol |
| WB protocol for KIF20A antibody 67190-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The KIF20A antibody (Cat# 67190-1-Ig) has 15 citations spanning journals including Cancer Research, Nature Communications, PNAS, Developmental Cell, Molecular Cancer Research, BMC Cancer, Genomics, Discover Oncology, International Journal of General Medicine, International Journal of Ophthalmology, Toxics, Advanced Science, and preprint servers. Research fields cover oncology (glioma, NSCLC, breast cancer, HCC, uveal melanoma), mitotic cell biology, reproductive development, pulmonary hypertension, ferroptosis, and immunotherapy resistance.
| Species | Application | Title |
|---|---|---|
Cancer Res Proteomic mapping and targeting of mitotic pericentriolar material in tumors bearing centrosome amplification. | ||
Nat Commun An oocyte meiotic midbody cap is required for developmental competence in mice | ||
Adv Sci (Weinh) The Hypoxia-Associated High-Risk Cell Subpopulation Distinctly Enhances the Progression of Glioma | ||
Proc Natl Acad Sci U S A Maternal genetic variants in kinesin motor domains prematurely increase egg aneuploidy | ||
Dev Cell DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice | ||
Mol Cancer Res Overlaid Transcriptional and Proteome Analyses Identify Mitotic Kinesins as Important Targets of Arylsulfonamide-Mediated RBM39 Degradation |
Reviews
What customers say
The single review for this antibody is a 5-star rating. The user reported using it for Western Blot at a 1:10,000 dilution and found that it works well to detect KIF20A in U2OS cell extracts. Overall, the feedback is positive, with the reviewer confirming reliable performance for their intended application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wissem (Verified Customer) (07-30-2024) | antibody works well to detect KIF20A in U2OS cell extracts
|
