KIF3C Recombinant monoclonal antibody

• 

  WB analysis using 87075-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87075-1-RR (KIF3C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

KIF3C Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87075-1-RR

Clone No.252142C8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Kinesin-like protein KIF3C

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, SW480 cells, HepG2 cells, Y79 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87075-1-RR targets KIF3C in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5619

  Product name: Recombinant human KIF3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-360 aa of BC042486

  Sequence: MASKTKASEALKVVARCRPLSRKEEAAGHEQILTMDVKLGQVTLRNPRAAPGELPKTFTFDAVYDASSKQADLIDSVLQGFNGTVFAYGQTGTGKTYTMQGTWVEPELRGVIPNAFEHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKEPGKRLELKENPETGVYIKDLSSFVTKNVKEIEHVMNLGNQTRAVGSTHMNEVSSRSHAIFIITVECSERGSDGQDHIRVGKLNLVDLAGSERQNKAGPNTAGGAATPSSGGGGGGGGSGGGAGGERPKEASKINLSLSALGNVIAALAGNRSTHIPYRDSKLTRLLQDSLGGNAKTIMVATLGPASHSYDESLSTLRFANRAKNIKNK

• Full Name: kinesin family member 3C
• Calculated Molecular Weight: 89 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC042486
• Gene Symbol: KIF3C
• Gene ID (NCBI): 3797
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14782
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIF3C(Kinesin Family Member 3C) is a member of Kinesin-2 family, which belongs to microtubule-dependent motor protein. It can generate mechanical energy by hydrolyzing ATP, and regulate many processes such as intracellular transport, cytoskeleton dynamics, cell division and migration. It plays an important role in nervous system, tumor and other tissues, and has gradually become a hot target of cancer and neurodegenerative diseases in recent years.