KIF4A Polyclonal antibody

• 

  IHC staining of human lung cancer using 14344-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung cancer using 14344-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung cancer using 14344-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung cancer using 14344-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung cancer using 14344-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung cancer using 14344-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 14344-1-AP

  Immunofluorescent analysis of HepG2 cells, using KIF4A antibody 14344-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

KIF4A Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 14344-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

Chromokinesin A, Chromokinesin-A, Chromosome-associated kinesin KIF4A, HSA271784, KIF4

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14344-1-AP targets KIF4A in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5682

  Product name: Recombinant human KIF4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC050548

  Sequence: MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQLLFKEIDKKSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISLEQRKKSDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVNIDPQTAEL

• Full Name: kinesin family member 4A
• Calculated Molecular Weight: 140 kDa
• GenBank Accession Number: BC050548
• Gene Symbol: KIF4A
• Gene ID (NCBI): 24137
• RRID: AB_2132200
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95239
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.