KIF4A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIF4A Polyclonal antibody, PBS Only (14344-1-PBS)

• 

  IHC staining of human lung cancer using 14344-1-AP (same clone as 14344-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14344-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14344-1-AP (same clone as 14344-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14344-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14344-1-AP (same clone as 14344-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14344-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14344-1-AP (same clone as 14344-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14344-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14344-1-AP (same clone as 14344-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14344-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14344-1-AP (same clone as 14344-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14344-1-AP (KIF4A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14344-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 14344-1-AP (same clone as 14344-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using KIF4A antibody 14344-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 14344-1-PBS in a different storage buffer formulation.

KIF4A Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 14344-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Chromokinesin A, Chromokinesin-A, Chromosome-associated kinesin KIF4A, HSA271784, KIF4

---

Product Information

14344-1-PBS targets KIF4A in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5682

  Product name: Recombinant human KIF4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC050548

  Sequence: MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQLLFKEIDKKSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISLEQRKKSDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDDKKGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVNIDPQTAEL

• Full Name: kinesin family member 4A
• Calculated Molecular Weight: 140 kDa
• GenBank Accession Number: BC050548
• Gene Symbol: KIF4A
• Gene ID (NCBI): 24137
• RRID: AB_2132200
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95239
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.