KIFAP3 Polyclonal antibody

• 

  WB analysis of human brain using 12700-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12700-1-AP (KIFAP3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 12700-1-AP

  WB result of KIFAP3 antibody (12700-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KIFAP3 transfected MCF-7 cells.

• 

  WB analysis of mouse testis using 12700-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 12700-1-AP (KIFAP3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12700-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12700-1-AP (KIFAP3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 12700-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 12700-1-AP (KIFAP3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 12700-1-AP

  IP result of anti-KIFAP3 (IP:12700-1-AP, 4ug; Detection:12700-1-AP 1:500) with mouse testis tissue lysate 4000ug.

• 

  IHC staining of human ovary cancer using 12700-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12700-1-AP (KIFAP3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 12700-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 12700-1-AP (KIFAP3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

KIFAP3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12700-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Kinesin-associated protein 3, kinesin associated protein 3, KIF3AP, KAP-3, KAP3

---

Tested Applications

• Positive WB detected in: human brain tissue, mouse testis tissue, mouse brain tissue, MCF-7 cells
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

12700-1-AP targets KIFAP3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3394

  Product name: Recombinant human KIFAP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 491-792 aa of BC028679

  Sequence: SQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS

• Full Name: kinesin-associated protein 3
• Calculated Molecular Weight: 792 aa, 91 kDa
• Observed Molecular Weight: 91-100 kDa
• GenBank Accession Number: BC028679
• Gene Symbol: KIFAP3
• Gene ID (NCBI): 22920
• RRID: AB_2132528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92845
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIFAP3, also known as KIF3AP or KAP3, is a novel KIF3A/3B-associated protein. It binds to the tail domain of KIF3A/3B and may play a role in regulating the binding of KIF3A/3B to cargoes. Recently it has been reported that mutation within the KIFAP3 gene is associated with decreased KIFAP3 expression and increased survival in sporadic ALS, which makes it a potential target for ALS therapy. KIFAP3 has also been identified as the target of mir-130a.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; A functional assay for microRNA target identification and validation.; Authors - G?ken Joop J
human	WB	Commun Biol; The germline factor DDX4 contributes to the chemoresistance of small cell lung cancer cells; Authors - Christopher Noyes