KIFC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIFC2 Polyclonal antibody, PBS Only (27470-1-PBS)

• 

  WB analysis of mouse brain using 27470-1-AP (same clone as 27470-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27470-1-AP (KIFC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27470-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 27470-1-AP (same clone as 27470-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using KIFC2 antibody (27470-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 27470-1-PBS in a different storage buffer formulation.

KIFC2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 27470-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

kinesin family member C2, Kinesin like protein KIFC2, Kinesin-like protein KIFC2

---

Product Information

27470-1-PBS targets KIFC2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26519

  Product name: Recombinant human KIFC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-254 aa of BC017311

  Sequence: RSPRGRQALLQGTQPAPRVRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGATDSEKRVQHLTLENEALKQSLSLMR

• Full Name: kinesin family member C2
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 96 kDa
• GenBank Accession Number: BC017311
• Gene Symbol: KIFC2
• Gene ID (NCBI): 90990
• RRID: AB_3742232
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AC6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Kinesin family member C2 (KIFC2), one of the kinesin-14 motor family members, is especially expressed in neurons and is important for organizing dendritic microtubules and to control dendrite development (PMID: 37716704). KIFC2 is a microtubule-binding protein that functions as a motor protein in vesicle transport along axons and/or dendrites. Western blot analysis detected KIFC2 at an apparent molecular mass of 96 kD(PMID: 9115737).