KIR2DL4/CD158d Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIR2DL4/CD158d Polyclonal antibody, PBS Only (32059-1-PBS)

• 

  WB analysis using 32059-1-AP (same clone as 32059-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32059-1-AP (KIR2DL4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32059-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NK-92 using 32059-1-AP (same clone as 32059-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NK-92 cells using KIR2DL4/CD158d antibody (32059-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 32059-1-PBS in a different storage buffer formulation.

KIR2DL4/CD158d Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 32059-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

KIR2DL4, CD158 antigen-like family member D, CD158D, G9P, Killer cell immunoglobulin-like receptor 2DL4

---

Product Information

32059-1-PBS targets KIR2DL4/CD158d in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1895

  Product name: Recombinant Human KIR2DL4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-242 aa of BC041611

  Sequence: HVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH

• Full Name: killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4
• Calculated Molecular Weight: 377 aa, 42 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC041611
• Gene Symbol: KIR2DL4
• Gene ID (NCBI): 3805
• RRID: AB_3670180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q99706
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells that regulate their responsiveness to signals received from their environment (PMID: 22934097). Killer cell immunoglobulin-like receptor 2DL4 (KIR2DL4, also known as CD158D and KIR103AS) is an unusual member of the KIRs family, which activates the cytotoxicity of NK cells. KIR2DL4 has two immunoglobulin domains and a single immunoreceptor tyrosine-based inhibition motif (ITIM) in the cytoplasmic tail with weak inhibitory potential (PMID: 12055234).