KIR3DL1/CD158E Polyclonal antibody

KIR3DL1/CD158E Polyclonal Antibody for WB, ELISA
Cat No. 13335-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

KIR3DL1, CD158 antigen-like family member E, CD158E, CD158E1, HLA-BW4-specific inhibitory NK cell receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman peripheral blood leukocytes

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13335-1-AP targets KIR3DL1/CD158E in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4152

Product name: Recombinant human KIR3DL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 22-344 aa of BC028206

Sequence: HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIG

Predict reactive species
Full Name killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1
Calculated Molecular Weight 444 aa, 49 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC028206
Gene Symbol KIR3DL1
Gene ID (NCBI) 3811
RRIDAB_2234189
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43629
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR3DL1 is a receptor on natural killer (NK) cells for HLA Bw4 allele. It inhibits the activity of NK cells thus preventing cell lysis. KIR3DL1 and KIR3DS1 are highly homologous. This antibody is raised against 22-344 amino acids of human KIR3DL1 and recognizes both KIR3DL1 (49 kDa) and KIR3DS1 (43 kDa).

Protocols

Product Specific Protocols
WB protocol for KIR3DL1/CD158E antibody 13335-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Clin Exp Immunol

Autoantibodies to Killer Cell Immunoglobulin-Like Receptor 3DL1 in Patients with Systemic Lupus Erythematosus.

Authors - Akihiro Doi
Loading...
||
New chat Able
正在加载,请稍候...