KIRREL Polyclonal antibody

• 

  WB analysis using 22232-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22232-1-AP (KIRREL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse kidney using 22232-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using KIRREL antibody (22232-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KIRREL Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 22232-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

Nephrin-like protein 1, NEPH1, KIRREL1, Kin of IRRE-like protein 1, Kin of irregular chiasm-like protein 1

---

Tested Applications

• Positive WB detected in: C2C12 cells, mouse brain tissue, mouse kidney tissue, mouse lung tissue, rat brain tissue
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22232-1-AP targets KIRREL in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17578

  Product name: Recombinant human KIRREL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 607-757 aa of BC109192

  Sequence: NVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQLNTYSRGPASDYGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLGYPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV

• Full Name: kin of IRRE like (Drosophila)
• Calculated Molecular Weight: 757 aa, 84 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC109192
• Gene Symbol: KIRREL
• Gene ID (NCBI): 55243
• RRID: AB_3085689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96J84
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kin of IRRE protein (KIRREL), also known as NEPH1, is a member of a podocin-binding protein family. KIRREL is a component of the podocyte slit diaphragm, which serves as the structural framework of the glomerular filtration barrier. KIRREL has three isoforms with molecular weights of 85 kDa, 83 kDa, and 72 kDa.