KLC3 Polyclonal antibody

• 

  WB analysis using 11645-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11645-1-AP (KLC3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 11645-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11645-1-AP (KLC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

KLC3 Polyclonal Antibody for WB, ELISA

Cat No. 11645-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

kinesin light chain 2, kinesin light chain 3, KLC2, KLC2 like, KLC2L, KLC3, KLCt, KNS2B

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human liver tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11645-1-AP targets KLC3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2243

  Product name: Recombinant human KLC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC025318

  Sequence: MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQVPRAGRGGGCWALHRAPQSPRPSLESHSPQDPP

• Full Name: kinesin light chain 3
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC025318
• Gene Symbol: KLC3
• Gene ID (NCBI): 147700
• RRID: AB_2132090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P597
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.