KLC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLC3 Polyclonal antibody, PBS Only (11645-1-PBS)

• 

  WB analysis using 11645-1-AP (same clone as 11645-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11645-1-AP (KLC3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11645-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 11645-1-AP (same clone as 11645-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 11645-1-AP (KLC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11645-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11645-1-AP (same clone as 11645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11645-1-AP (KLC3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11645-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11645-1-AP (same clone as 11645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11645-1-AP (KLC3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11645-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11645-1-AP (same clone as 11645-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using KLC3 antibody (11645-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11645-1-PBS in a different storage buffer formulation.

KLC3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11645-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

kinesin light chain 2, Kinesin light chain 3, KLC2, KLC2 like, KLC2L

---

Product Information

11645-1-PBS targets KLC3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2243

  Product name: Recombinant human KLC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC025318

  Sequence: MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQVPRAGRGGGCWALHRAPQSPRPSLESHSPQDPP

• Full Name: kinesin light chain 3
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC025318
• Gene Symbol: KLC3
• Gene ID (NCBI): 147700
• RRID: AB_2132090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P597
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.