KLF11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KLF11 Polyclonal antibody (34052-1-AP)

KLF11 Polyclonal Antibody for WB, ELISA

Cat No. 34052-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ChIP, ELISA

Synonyms

FKLF, FKLF1, Krueppel like factor 11, Kruppel like factor 11, MODY7

• 

  WB analysis using 34052-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34052-1-AP (KLF11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KLF11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse embryo tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34052-1-AP targets KLF11 in WB, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40584

  Product name: Recombinant human KLF11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC063286

  Sequence: MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDS

• Full Name: Kruppel-like factor 11
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC063286
• Gene Symbol: KLF11
• Gene ID (NCBI): 8462
• RRID: AB_3743144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O14901
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLF11 (Krüppel-like factor 11) belongs to the zinc finger transcription factor family. Its C-terminus contains three tandem C2H2-type zinc finger domains responsible for sequence-specific DNA binding. It regulates transcription by binding to the GC box or CACCC element of target gene promoters, and in the pancreas, it negatively regulates insulin gene expression as a transcriptional repressor. Furthermore, KLF11 participates in cell cycle regulation, apoptosis, and fibrosis pathways, possesses tumor-suppressive functions.

Publications

What published studies show

The KLF11 antibody (catalog number 34052-1-AP) has 2 total citations. These appear in the journals Arthritis Research & Therapy and Molecular Cell Biology. The associated research fields include rheumatoid arthritis (regulating M1 macrophage polarization via YAP1 downregulation) and colorectal cancer (extracellular vesicles from adMSCs suppressing SOAT1-mediated lipogenesis).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	ChIP	Arthritis Res Ther; KLF11 alleviates rheumatoid arthritis by regulating M1 macrophage polarization via downregulation of YAP1 expression.; Authors - Xiaodan Liu
		Mol Cell Biol; KLF11 in Extracellular Vesicles Derived from adMSCs Inhibits Colorectal Cancer via Suppressing SOAT1-Mediated Lipogenesis.; Authors - Fan Yang