KLF15 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KLF15 Polyclonal antibody (13749-1-AP)

• Featured Product
• KD/KO Validated

KLF15 Polyclonal Antibody for WB, ELISA

Cat No. 13749-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, CoIP, ChIP, ELISA

Synonyms

KKLF, KLF15, Krueppel like factor 15, Kruppel like factor 15

• 

  WB analysis using 13749-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13749-1-AP (KLF15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13749-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13749-1-AP (KLF15 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KLF15 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, MDA-MB-231 cells, 3T3-L1 cells, C2C12 cells, mouse heart tissue, mouse kidney tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13749-1-AP targets KLF15 in WB, IF, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4690

  Product name: Recombinant human KLF15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-416 aa of BC036733

  Sequence: MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN

• Full Name: Kruppel-like factor 15
• Calculated Molecular Weight: 416 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC036733
• Gene Symbol: KLF15
• Gene ID (NCBI): 28999
• RRID: AB_2132428
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UIH9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLF15, a kidney-enriched Krüppel-like zinc finger-containing transcription factors, is a transcriptonal activator that binds the CLCNKA promoter. The nuclear protein KLF15, is expressed primarily in liver, heart, skeletal muscle and kidney tissues but is not detected in lymphoid tissues or bone marrow. It is an important regulator of GLUT4 in both adipose and muscle tissues.Although the calculated molecular mass of KLF15 is 44 kDa, the apparent molecular mass on SDS-PAGE is 65 kDa due to the post-translational modifications (PMID:10982849,PMID:16615998).

Publications

What published studies show

The KLF15 antibody (Cat# 13749-1-AP) has 11 total citations spanning journals including Cell Metabolism, Cancer Letters, JCI Insight, Molecular Neurobiology, FASEB Journal, Epigenomics, Molecular Cell Biology, PLoS One, Korean Journal of Physiology and Pharmacology, and Molecular Genetics and Genomics. Research fields cover skeletal muscle metabolism, ferroptosis in lung cancer, insulin sensitivity, cardiac mitochondrial dysfunction, acute kidney injury, diabetic cardiomyopathy, muscle differentiation, endoplasmic reticulum stress, fibrosis, osteoarthritis, and diabetic kidney disease.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,ChIP	Cell Metab; Crosstalk between glucocorticoid receptor and nutritional sensor mTOR in skeletal muscle.; Authors - Noriaki Shimizu
human	WB	Cancer Lett; Hinokitiol preferentially suppresses metastatic lung adenocarcinoma via TMDD1-mediated ferroptosis induction and iron-sulfur cluster inhibition.; Authors - Yanbin Kuang ; KO Validated
mouse	WB	JCI Insight; Gc inhibition preserves insulin sensitivity and reduces body weight without loss of muscle mass.; Authors - Richard Gill
mouse,rat	WB	Mol Neurobiol; Renal Denervation Improves Myocardial Mitochondrial Dysfunction and Myocardial Fibrosis by Inhibiting the NE/KLF15/renalase Pathway; Authors - Ye Chen
human	WB,ChIP	FASEB J; Cordycepin Suppressed Ferroptosis to Ameliorate Acute Kidney Injury Through Inhibiting the DNMT1/KLF15/FTH1 Axis.; Authors - Li Chen ; KD Validated
mouse	WB,IF	Epigenomics; Multi-omics insights into the pathogenesis of diabetic cardiomyopathy: epigenetic and metabolic profiles; Authors - Li Zhou