KLF17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLF17 Polyclonal antibody, PBS Only (17612-1-PBS)

• 

  WB analysis of MCF-7 using 17612-1-AP (same clone as 17612-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 17612-1-AP (KLF17 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17612-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 17612-1-AP (same clone as 17612-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 17612-1-AP (KLF17 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17612-1-PBS in a different storage buffer formulation.

KLF17 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17612-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17612-1-PBS targets KLF17 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11776

  Product name: Recombinant human KLF17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-389 aa of BC049844

  Sequence: MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPTIQHFPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPSGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP

• Full Name: Kruppel-like factor 17
• Calculated Molecular Weight: 389 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC049844
• Gene Symbol: KLF17
• Gene ID (NCBI): 128209
• RRID: AB_2878419
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JT82
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.