KLF4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLF4 Polyclonal antibody, PBS Only (11880-1-PBS)

• 

  WB analysis using 11880-1-AP (same clone as 11880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11880-1-AP (KLF4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11880-1-AP (same clone as 11880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11880-1-AP (KLF4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11880-1-AP (same clone as 11880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11880-1-AP (KLF4 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11880-1-AP (same clone as 11880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11880-1-AP (KLF4 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11880-1-AP (same clone as 11880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11880-1-AP (KLF4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 11880-1-AP (same clone as 11880-1-PBS)

  NCCIT cell were subjected to SDS PAGE followed by western blot with 11880-1-AP (KLF4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 11880-1-AP (same clone as 11880-1-PBS)

  IP result of anti-KLF4 (IP:11880-1-AP, 4ug; Detection:11880-1-AP 1:8000) with HeLa cells lysate 1320 ug. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 11880-1-AP (KLF4 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsil using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsil using 11880-1-AP (KLF4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsil using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsil using 11880-1-AP (KLF4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 11880-1-AP (KLF4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 11880-1-AP (KLF4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 11880-1-AP (KLF4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 11880-1-AP (KLF4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse embryo using 11880-1-AP (same clone as 11880-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse embryo tissue slide using 11880-1-AP (KLF4 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human embronic stem cells using 11880-1-AP (same clone as 11880-1-PBS)

  Confocal immunofluorescent analysis of human embronic stem cells with 11880-1-AP at dilution of 1:50. The PE shows staining with 11880-1-AP/PE. The DAPI shows nuclear staining by DAPI. This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 11880-1-AP (same clone as 11880-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human KLF4 (11880-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 11880-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KLF4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 11880-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

---

Product Information

11880-1-PBS targets KLF4 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2480

  Product name: Recombinant human KLF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-504 aa of BC030811

  Sequence: IPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

• Full Name: Kruppel-like factor 4 (gut)
• Calculated Molecular Weight: 504 aa, 54 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC030811
• Gene Symbol: KLF4
• Gene ID (NCBI): 9314
• RRID: AB_10640807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43474
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mammalian Krüppel-like transcription factor 4 (Klf4) is an evolutionarily conserved zinc finger-containing transcription factor with diverse regulatory functions in cell growth, proliferation, differentiation and embryogenesis. It also plays a significant role in the process of tumorigenesis. Klf4 is one of the key transcription factors that have been used to reprogram mouse and human fibroblasts to a pluripotent state also called induced pluripotent stem (iPS) cells. Affinity purified rabbit anti- Klf4 is for the detection of Klf4 transgene expression in the process of reprogramming. There are two isoforms of KLF4 (PMID: 15561714), with MW range from 50 to 60 kDa,and major band is 55 kDa. KLF4 protein can be ubiquitin modified.